Recombinant Human CLLU1 Protein, GST-tagged

• Cat.No.: CLLU1-1503H
• Product Overview: Human CLLU1 full-length ORF ( AAI46526.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Expression of this gene has been shown to be upregulated in some individuals with chronic lymphocytic leukemia (CLL), and has been used for prognostic and diagnostic purposes. This gene was originally identified as a human-specific putative protein-coding gene due to the presence of a peptide (PAp00140670, HIIYSTFLSK) that could have supported translation at this locus. This peptide is not present in more recent builds of PeptideAtlas, and the presence of a protein product at this locus has not been independently verified. For this reason, this gene is being represented as non-coding. Sequence comparisons to other primates indicates that no other primate is predicted to contain an open reading frame. [provided by RefSeq, Feb 2017]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.26 kDa
• AA Sequence: MFNKCSFHSSIYRPAADNSASSLCAIICFLNLVIECDLETNSEINKLIIYLFSQNNRIRFSKLLLKILFYISIFSYPELMCEQYVTFIKPGIHYGQVSKKHIIYSTFLSKNFKFQLLRVCW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLLU1 chronic lymphocytic leukemia up-regulated 1 [ Homo sapiens (human) ]
• Official Symbol: CLLU1
• Synonyms: CLLU1; chronic lymphocytic leukemia up-regulated 1; Chronic Lymphocytic Leukemia Up-Regulated 1
• Gene ID: 574028
• MIM: 616988
• UniProt ID: Q5K131