Recombinant Human CLLU1 Protein, GST-tagged
Cat.No. : | CLLU1-1503H |
Product Overview : | Human CLLU1 full-length ORF ( AAI46526.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Expression of this gene has been shown to be upregulated in some individuals with chronic lymphocytic leukemia (CLL), and has been used for prognostic and diagnostic purposes. This gene was originally identified as a human-specific putative protein-coding gene due to the presence of a peptide (PAp00140670, HIIYSTFLSK) that could have supported translation at this locus. This peptide is not present in more recent builds of PeptideAtlas, and the presence of a protein product at this locus has not been independently verified. For this reason, this gene is being represented as non-coding. Sequence comparisons to other primates indicates that no other primate is predicted to contain an open reading frame. [provided by RefSeq, Feb 2017] |
Molecular Mass : | 40.26 kDa |
AA Sequence : | MFNKCSFHSSIYRPAADNSASSLCAIICFLNLVIECDLETNSEINKLIIYLFSQNNRIRFSKLLLKILFYISIFSYPELMCEQYVTFIKPGIHYGQVSKKHIIYSTFLSKNFKFQLLRVCW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLLU1 chronic lymphocytic leukemia up-regulated 1 [ Homo sapiens (human) ] |
Official Symbol | CLLU1 |
Synonyms | CLLU1; chronic lymphocytic leukemia up-regulated 1; Chronic Lymphocytic Leukemia Up-Regulated 1 |
Gene ID | 574028 |
MIM | 616988 |
UniProt ID | Q5K131 |
◆ Recombinant Proteins | ||
CLLU1-2207HF | Recombinant Full Length Human CLLU1 Protein, GST-tagged | +Inquiry |
CLLU1-1503H | Recombinant Human CLLU1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLLU1 Products
Required fields are marked with *
My Review for All CLLU1 Products
Required fields are marked with *
0
Inquiry Basket