Recombinant Human CLIC4, His-tagged

• Cat.No.: CLIC4-27273TH
• Product Overview: Recombinant full length Human CLIC4 with an N terminal His tag; 273 amino acids with a predicted MWt 30.9 kDa including tag.

Specification

• Description: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).
• Protein length: 253 amino acids
• Conjugation: HIS
• Molecular Weight: 30.900kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Detected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
• Sequence Similarities: Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain.

Gene Information

• Gene Name: CLIC4 chloride intracellular channel 4 [ Homo sapiens ]
• Official Symbol: CLIC4
• Synonyms: CLIC4; chloride intracellular channel 4; chloride intracellular channel protein 4; CLIC4L; DKFZP566G223; H1; huH1; p64H1; P64H1
• Gene ID: 25932
• mRNA Refseq: NM_013943
• Protein Refseq: NP_039234
• MIM: 606536
• Uniprot ID: Q9Y696
• Chromosome Location: 1p
• Function: chloride channel activity; protein binding; voltage-gated chloride channel activity; voltage-gated ion channel activity