Recombinant Human CLIC3 protein, T7-tagged

• Cat.No.: CLIC3-155H
• Product Overview: Recombinant human CLIC3 (236 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 236 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRAL ARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM QEKEFKYTCPHSAEILAAYRPAVHPR
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: CLIC3 chloride intracellular channel 3 [ Homo sapiens ]
• Official Symbol: CLIC3
• Synonyms: CLIC3; chloride intracellular channel 3; chloride intracellular channel protein 3
• Gene ID: 9022
• mRNA Refseq: NM_004669
• Protein Refseq: NP_004660
• MIM: 606533
• UniProt ID: O95833
• Chromosome Location: 9q34.3
• Function: chloride channel activity; protein binding; voltage-gated chloride channel activity; voltage-gated ion channel activity