Recombinant Human CLIC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CLIC1-5937H
Product Overview : CLIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001279) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
Molecular Mass : 26.7 kDa
AA Sequence : MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLIC1 chloride intracellular channel 1 [ Homo sapiens (human) ]
Official Symbol CLIC1
Synonyms CLIC1; chloride intracellular channel 1; chloride intracellular channel protein 1; NCC27; p64CLCP; hRNCC; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein; G6;
Gene ID 1192
mRNA Refseq NM_001288
Protein Refseq NP_001279
MIM 602872
UniProt ID O00299

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLIC1 Products

Required fields are marked with *

My Review for All CLIC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon