Recombinant Human CLEC7A Protein, His-tagged
Cat.No. : | CLEC7A-131H |
Product Overview : | Recombinant Human CLEC7A Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Dectin-1 is a C-type lectin receptor expressed by macrophages, monocytes, dendrtic cells, neutrophils, and a subset of γδ T cells. Dectin-1 is a glycoprotein with eight different isoforms, generated through alternative splicing. It plays an important role in anti-fungal immunity by acting as a pattern recognition receptor for β-glucans found on the cell wall of fungi and some bacteria. Dectin-1 is composed of a short amino-terminal cytoplasmic domain containing an ITAM-like motif, a transmembrane domain, and an extracellular carboxy-terminal C-type lectin domain. Dectin-1 recognizes β-glucans through its C-type lectin domain and transduces signals through its ITAM-like motif by recruiting and activating Syk. Dendritic cells activated through Dectin-1 promote differentiation of Th17 cells by producing IL-6 and IL-23. |
Molecular Mass : | ~21 kDa |
AA Sequence : | TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CLEC7A C-type lectin domain family 7, member A [ Homo sapiens (human) ] |
Official Symbol | CLEC7A |
Synonyms | CLEC7A; C-type lectin domain family 7, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12 , CLECSF12; C-type lectin domain family 7 member A; dectin 1; hDectin 1; dectin-1; beta-glucan receptor; lectin-like receptor 1; DC-associated C-type lectin 1; C-type lectin superfamily member 12; dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; BGR; CANDF4; DECTIN1; CLECSF12; |
Gene ID | 64581 |
mRNA Refseq | NM_022570 |
Protein Refseq | NP_072092 |
MIM | 606264 |
UniProt ID | Q9BXN2 |
◆ Recombinant Proteins | ||
CLEC7A-732R | Recombinant Rhesus Macaque CLEC7A Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC7A-2172HF | Recombinant Full Length Human CLEC7A Protein, GST-tagged | +Inquiry |
CLEC7A-1473H | Recombinant Human CLEC7A Protein, GST-tagged | +Inquiry |
CLEC7A-261H | Recombinant Human CLEC7A, Fc-tagged | +Inquiry |
CLEC7A-1697H | Recombinant Human CLEC7A protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC7A-760HCL | Recombinant Human CLEC7A cell lysate | +Inquiry |
CLEC7A-2455MCL | Recombinant Mouse CLEC7A cell lysate | +Inquiry |
CLEC7A-001HCL | Recombinant Human CLEC7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC7A Products
Required fields are marked with *
My Review for All CLEC7A Products
Required fields are marked with *
0
Inquiry Basket