Recombinant Human CLEC7A Protein, His-tagged

Cat.No. : CLEC7A-131H
Product Overview : Recombinant Human CLEC7A Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Dectin-1 is a C-type lectin receptor expressed by macrophages, monocytes, dendrtic cells, neutrophils, and a subset of γδ T cells. Dectin-1 is a glycoprotein with eight different isoforms, generated through alternative splicing. It plays an important role in anti-fungal immunity by acting as a pattern recognition receptor for β-glucans found on the cell wall of fungi and some bacteria. Dectin-1 is composed of a short amino-terminal cytoplasmic domain containing an ITAM-like motif, a transmembrane domain, and an extracellular carboxy-terminal C-type lectin domain. Dectin-1 recognizes β-glucans through its C-type lectin domain and transduces signals through its ITAM-like motif by recruiting and activating Syk. Dendritic cells activated through Dectin-1 promote differentiation of Th17 cells by producing IL-6 and IL-23.
Molecular Mass : ~21 kDa
AA Sequence : TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name CLEC7A C-type lectin domain family 7, member A [ Homo sapiens (human) ]
Official Symbol CLEC7A
Synonyms CLEC7A; C-type lectin domain family 7, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12 , CLECSF12; C-type lectin domain family 7 member A; dectin 1; hDectin 1; dectin-1; beta-glucan receptor; lectin-like receptor 1; DC-associated C-type lectin 1; C-type lectin superfamily member 12; dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; BGR; CANDF4; DECTIN1; CLECSF12;
Gene ID 64581
mRNA Refseq NM_022570
Protein Refseq NP_072092
MIM 606264
UniProt ID Q9BXN2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC7A Products

Required fields are marked with *

My Review for All CLEC7A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon