Recombinant Human CLEC7A Protein, GST-tagged

• Cat.No.: CLEC7A-1473H
• Product Overview: Human CLEC7A full-length ORF ( AAH13385, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.21 kDa
• AA Sequence: MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC7A C-type lectin domain family 7, member A [ Homo sapiens ]
• Official Symbol: CLEC7A
• Synonyms: CLEC7A; C-type lectin domain family 7, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 12 , CLECSF12; C-type lectin domain family 7 member A; dectin 1; hDectin 1; dectin-1; beta-glucan receptor; lectin-like receptor 1; DC-associated C-type lectin 1; C-type lectin superfamily member 12; dendritic cell-associated C-type lectin 1; dendritic cell-associated C-type lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 12; BGR; CANDF4; DECTIN1; CLECSF12
• Gene ID: 64581
• mRNA Refseq: NM_022570
• Protein Refseq: NP_072092
• MIM: 606264
• UniProt ID: Q9BXN2