Recombinant Human CLEC5A Protein, GST-tagged

• Cat.No.: CLEC5A-1472H
• Product Overview: Human CLEC5A full-length ORF ( NP_037384.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.9 kDa
• AA Sequence: MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC5A C-type lectin domain family 5, member A [ Homo sapiens ]
• Official Symbol: CLEC5A
• Synonyms: CLEC5A; C-type lectin domain family 5, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 5 , CLECSF5; C-type lectin domain family 5 member A; MDL 1; C-type lectin superfamily member 5; myeloid DAP12-associating lectin 1; myeloid DAP12-associating lectin-1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5; MDL1; MDL-1; CLECSF5; MGC138304
• Gene ID: 23601
• mRNA Refseq: NM_013252
• Protein Refseq: NP_037384
• MIM: 604987
• UniProt ID: Q9NY25