Recombinant Human CLEC2D Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CLEC2D-6077H
• Product Overview: CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.1 kDa
• AA Sequence: MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CLEC2D C-type lectin domain family 2 member D [ Homo sapiens (human) ]
• Official Symbol: CLEC2D
• Synonyms: CLEC2D; C-type lectin domain family 2, member D; C type lectin superfamily 2, member D; C-type lectin domain family 2 member D; C type lectin related f; CLAX; lectin like transcript 1; LLT1; OCIL; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D
• Gene ID: 29121
• mRNA Refseq: NM_001004419
• Protein Refseq: NP_001004419
• MIM: 605659
• UniProt ID: Q9UHP7