Recombinant Human CLEC2B Protein, GST-tagged

Cat.No. : CLEC2B-1462H
Product Overview : Human CLEC2B full-length ORF ( AAH05254, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
Molecular Mass : 42.13 kDa
AA Sequence : MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLEC2B C-type lectin domain family 2, member B [ Homo sapiens ]
Official Symbol CLEC2B
Synonyms CLEC2B; C-type lectin domain family 2, member B; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 2 (activation induced) , CLECSF2; C-type lectin domain family 2 member B; AICL; HP10085; activation-induced C-type lectin; C-type lectin superfamily member 2; IFN-alpha2b-inducing related protein 1; IFN-alpha-2b-inducing-related protein 1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced); IFNRG1; CLECSF2;
Gene ID 9976
mRNA Refseq NM_005127
Protein Refseq NP_005118
MIM 603242
UniProt ID Q92478

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC2B Products

Required fields are marked with *

My Review for All CLEC2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon