Recombinant Human CLEC2B Protein, GST-tagged

Description :	This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	42.13 kDa
AA Sequence :	MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CLEC2B C-type lectin domain family 2, member B [ Homo sapiens ]
Official Symbol	CLEC2B
Synonyms	CLEC2B; C-type lectin domain family 2, member B; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 2 (activation induced) , CLECSF2; C-type lectin domain family 2 member B; AICL; HP10085; activation-induced C-type lectin; C-type lectin superfamily member 2; IFN-alpha2b-inducing related protein 1; IFN-alpha-2b-inducing-related protein 1; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced); IFNRG1; CLECSF2;
Gene ID	9976
mRNA Refseq	NM_005127
Protein Refseq	NP_005118
MIM	603242
UniProt ID	Q92478