Recombinant Human CLEC2A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLEC2A-3165H |
Product Overview : | CLEC2A MS Standard C13 and N15-labeled recombinant protein (NP_001124183) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors. |
Molecular Mass : | 19.8 kDa |
AA Sequence : | MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLEC2A C-type lectin domain family 2 member A [ Homo sapiens (human) ] |
Official Symbol | CLEC2A |
Synonyms | CLEC2A; C-type lectin domain family 2, member A; C-type lectin domain family 2 member A; INPE5792; KACL; keratinocyte associated C type lectin; PILAR; proliferation induced lymphocyte associated receptor; UNQ5792; keratinocyte-associated C-type lectin; proliferation-induced lymphocyte-associated receptor; |
Gene ID | 387836 |
mRNA Refseq | NM_001130711 |
Protein Refseq | NP_001124183 |
MIM | 612087 |
UniProt ID | Q6UVW9 |
◆ Recombinant Proteins | ||
CLEC2A-3241H | Recombinant Human CLEC2A Protein, MYC/DDK-tagged | +Inquiry |
CLEC2A-3165H | Recombinant Human CLEC2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC2A Products
Required fields are marked with *
My Review for All CLEC2A Products
Required fields are marked with *
0
Inquiry Basket