Recombinant Human CLEC2A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CLEC2A-3165H
• Product Overview: CLEC2A MS Standard C13 and N15-labeled recombinant protein (NP_001124183) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.8 kDa
• AA Sequence: MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CLEC2A C-type lectin domain family 2 member A [ Homo sapiens (human) ]
• Official Symbol: CLEC2A
• Synonyms: CLEC2A; C-type lectin domain family 2, member A; C-type lectin domain family 2 member A; INPE5792; KACL; keratinocyte associated C type lectin; PILAR; proliferation induced lymphocyte associated receptor; UNQ5792; keratinocyte-associated C-type lectin; proliferation-induced lymphocyte-associated receptor
• Gene ID: 387836
• mRNA Refseq: NM_001130711
• Protein Refseq: NP_001124183
• MIM: 612087
• UniProt ID: Q6UVW9