Recombinant Human CLDN6 Full Length Transmembrane protein, GFP-tagged

• Cat.No.: CLDN6-0193H
• Product Overview: Recombinant Human CLDN6 protein(P56747)(1-220aa), fused with C-terminal GFP tag(This tag can be tested only under denaturing conditions), was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: GFP
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.5 kDa
• Protein length: 1-220aa
• AA Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CLDN6 claudin 6 [ Homo sapiens ]
• Official Symbol: CLDN6
• Synonyms: CLDN6; claudin 6; claudin-6; skullin
• Gene ID: 9074
• mRNA Refseq: NM_021195
• Protein Refseq: NP_067018
• UniProt ID: P56747