Recombinant Human CLCN3 Protein, GST-tagged

• Cat.No.: CLCN3-1417H
• Product Overview: Human CLCN3 partial ORF ( NP_001820.2, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the voltage-gated chloride channel (ClC) family. The encoded protein is present in all cell types and localized in plasma membranes and in intracellular vesicles. It is a multi-pass membrane protein which contains a ClC domain and two additional C-terminal CBS (cystathionine beta-synthase) domains. The ClC domain catalyzes the selective flow of Cl- ions across cell membranes, and the CBS domain may have a regulatory function. This protein plays a role in both acidification and transmitter loading of GABAergic synaptic vesicles, and in smooth muscle cell activation and neointima formation. This protein is required for lysophosphatidic acid (LPA)-activated Cl- current activity and fibroblast-to-myofibroblast differentiation. The protein activity is regulated by Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) in glioma cells. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLCN3 chloride channel, voltage-sensitive 3 [ Homo sapiens ]
• Official Symbol: CLCN3
• Synonyms: CLCN3; chloride channel, voltage-sensitive 3; chloride channel 3; H(+)/Cl(-) exchange transporter 3; ClC 3; CLC3; chloride channel protein 3; chloride transporter ClC-3; ClC-3; DKFZp564I0463
• Gene ID: 1182
• mRNA Refseq: NM_001243372
• Protein Refseq: NP_001230301
• MIM: 600580
• UniProt ID: P51790