Recombinant Human CLCA1 protein, GST-tagged

• Cat.No.: CLCA1-27070TH
• Product Overview: Recombinant Human CLCA1(677 a.a. - 776 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 677-776 a.a.
• Description: This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLF PPGQITDLKAEIHGGSLINLTWTAP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CLCA1 chloride channel accessory 1 [ Homo sapiens ]
• Official Symbol: CLCA1
• Synonyms: CLCA1; chloride channel accessory 1; chloride channel regulator 1 , chloride channel, calcium activated, family member 1; calcium-activated chloride channel regulator 1; CaCC; CLCRG1; chloride channel regulator 1; calcium-dependent chloride channel-1; calcium-activated chloride channel protein 1; CLCA family member 1, chloride channel regulator; calcium-activated chloride channel family member 1; chloride channel, calcium activated, family member 1; CACC; GOB5; CACC1; CaCC-1; hCLCA1; hCaCC-1; FLJ95147
• Gene ID: 1179
• mRNA Refseq: NM_001285
• Protein Refseq: NP_001276
• MIM: 603906
• UniProt ID: A8K7I4
• Chromosome Location: 1p22.3
• Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem
• Function: chloride channel activity