Recombinant Human CKB Protein, GST-tagged
Cat.No. : | CKB-1391H |
Product Overview : | Human CKB full-length ORF ( AAH01190, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 67.65 kDa |
AA Sequence : | MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CKB creatine kinase, brain [ Homo sapiens ] |
Official Symbol | CKB |
Synonyms | CKB; creatine kinase, brain; CKBB; creatine kinase B-type; creatine kinase-B; creatine kinase B chain; B-CK; |
Gene ID | 1152 |
mRNA Refseq | NM_001823 |
Protein Refseq | NP_001814 |
MIM | 123280 |
UniProt ID | P12277 |
◆ Recombinant Proteins | ||
CKBB-9496Z | Recombinant Zebrafish CKBB | +Inquiry |
Ckb-2128M | Recombinant Mouse Ckb protein, His-tagged | +Inquiry |
Ckb-895M | Recombinant Mouse Ckb Protein, MYC/DDK-tagged | +Inquiry |
CKB-11263H | Recombinant Human CKB, GST-tagged | +Inquiry |
CKB -2152H | Recombinant Human CKB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
CKB-8079H | Active Native Human CKB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKB-001HCL | Recombinant Human CKB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CKB Products
Required fields are marked with *
My Review for All CKB Products
Required fields are marked with *
0
Inquiry Basket