Recombinant Human CKB, His-tagged

• Cat.No.: CKB-26520TH
• Product Overview: Recombinant full length Human Creatine Kinase BB with N-terminal His tag; 401 amino acids, MWt 44.8 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 381 amino acids
• Description: The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.
• Conjugation: HIS
• Molecular Weight: 44.800kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
• Sequence Similarities: Belongs to the ATP:guanido phosphotransferase family.Contains 1 phosphagen kinase C-terminal domain.Contains 1 phosphagen kinase N-terminal domain.

Gene Information

• Gene Name: CKB creatine kinase, brain [ Homo sapiens ]
• Official Symbol: CKB
• Synonyms: CKB; creatine kinase, brain; CKBB; creatine kinase B-type
• Gene ID: 1152
• mRNA Refseq: NM_001823
• Protein Refseq: NP_001814
• MIM: 123280
• Uniprot ID: P12277
• Chromosome Location: 14q32.3
• Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem
• Function: ATP binding; creatine kinase activity; nucleotide binding