Recombinant Human CKAP4 protein, His-tagged
Cat.No. : | CKAP4-28002TH |
Product Overview : | Recombinant Human CKAP4 protein(254-602 aa), fused with His tag, was expressed in E.coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 254-602 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CKAP4 cytoskeleton-associated protein 4 [ Homo sapiens ] |
Official Symbol | CKAP4 |
Synonyms | CKAP4; cytoskeleton-associated protein 4; CLIMP 63; ERGIC 63; P63; 63 kDa membrane protein; type-II transmembrane protein p63; 63-kDa cytoskeleton-linking membrane protein; transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediate compartment; p63; CLIMP-63; ERGIC-63; MGC99554; |
Gene ID | 10970 |
mRNA Refseq | NM_006825 |
Protein Refseq | NP_006816 |
UniProt ID | Q07065 |
◆ Recombinant Proteins | ||
CKAP4-001H | Recombinant Human CKAP4 protein, His-tagged | +Inquiry |
CKAP4-3492M | Recombinant Mouse CKAP4 Protein | +Inquiry |
CKAP4-1705M | Recombinant Mouse CKAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CKAP4-2819M | Recombinant Mouse CKAP4 Protein (109-575 aa), His-MBP-tagged | +Inquiry |
CKAP4-11261H | Recombinant Human CKAP4, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CKAP4 Products
Required fields are marked with *
My Review for All CKAP4 Products
Required fields are marked with *
0
Inquiry Basket