Recombinant Human CITED4 Protein, GST-tagged

• Cat.No.: CITED4-1388H
• Product Overview: Human CITED4 partial ORF ( NP_597724.1, 131 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this intronless gene belongs to the CITED family of transcriptional coactivators that bind to several proteins, including CREB-binding protein (CBP) and p300, via a conserved 32 aa C-terminal motif, and regulate gene transcription. This protein also interacts with transcription factor AP2 (TFAP2), and thus may function as a co-activator for TFAP2. Hypermethylation and transcriptional downregulation of this gene has been observed in oligodendroglial tumors with deletions of chromosomal arms 1p and 19q, and associated with longer recurrence-free and overall survival of patients with oligodendroglial tumors. [provided by RefSeq, Aug 2011]
• Molecular Mass: 31.68 kDa
• AA Sequence: GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CITED4 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 [ Homo sapiens ]
• Official Symbol: CITED4
• Synonyms: CITED4; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4; cbp/p300-interacting transactivator 4; transcriptional co activator 4; MRG-2; MSG1-related protein 2; transcriptional co-activator 4
• Gene ID: 163732
• mRNA Refseq: NM_133467
• Protein Refseq: NP_597724
• MIM: 606815
• UniProt ID: Q96RK1