Recombinant Human CISD2 Protein, GST-tagged

• Cat.No.: CISD2-1379H
• Product Overview: Human CISD2 full-length ORF ( NP_001008389.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2. [provided by RefSeq, Mar 2011]
• Molecular Mass: 41.7 kDa
• AA Sequence: MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CISD2 CDGSH iron sulfur domain 2 [ Homo sapiens ]
• Official Symbol: CISD2
• Synonyms: 1500009M05Rik; 1500026J14Rik; 1500031D15Rik; AI848398; B630006A20Rik; CDGSH iron sulfur domain 2; CDGSH iron-sulfur domain-containing protein 2; CDGSH type domain 2; CISD2; CISD2_HUMAN; Endoplasmic reticulum intermembrane small protein; ERIS; Miner1; MitoNEET related 1; MitoNEET-related 1 protein; NAF-1; Noxp70; Nutrient deprivation autophagy factor 1; Nutrient-deprivation autophagy factor-1; OTTHUMP00000219576; RGD1566242; WFS2; Zcd2; Zinc finger; Zinc finger, CDGSH type domain 2
• Gene ID: 493856
• mRNA Refseq: NM_001008388.4
• Protein Refseq: NP_001008389.1
• MIM: 611507
• UniProt ID: Q8N5K1