Recombinant Full Length Human CIRBP Protein
Cat.No. : | CIRBP-82HF |
Product Overview : | Recombinant full length Human CIRBP with N-terminal proprietary tag. Predicted MW 45.03kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 172 amino acids |
Description : | Cold-inducible RNA-binding protein is a protein that in humans is encoded by the CIRBP gene. |
Form : | Liquid |
Molecular Mass : | 45.030kDa inclusive of tags |
AA Sequence : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKD RETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVD QAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSY RDSYDSYATHNE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CIRBP cold inducible RNA binding protein [ Homo sapiens ] |
Official Symbol | CIRBP |
Synonyms | CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein |
Gene ID | 1153 |
mRNA Refseq | NM_001280 |
Protein Refseq | NP_001271 |
MIM | 602649 |
UniProt ID | Q14011 |
◆ Recombinant Proteins | ||
CIRBP-3755Z | Recombinant Zebrafish CIRBP | +Inquiry |
CIRBP-3046H | Recombinant Human Cold Inducible RNA Binding Protein, His-tagged | +Inquiry |
CIRBP-6455HFL | Recombinant Full Length Human CIRBP protein, Flag-tagged | +Inquiry |
CIRBP-3479M | Recombinant Mouse CIRBP Protein | +Inquiry |
CIRBP-27194TH | Active Recombinant Human CIRBP protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CIRBP Products
Required fields are marked with *
My Review for All CIRBP Products
Required fields are marked with *
0
Inquiry Basket