Recombinant Human CINP, His-tagged

• Cat.No.: CINP-27247TH
• Product Overview: Recombinant full length Human CINP with an N terminal His tag; 232 amino acids with tag, Predicted MWt 26.4 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 212 amino acids
• Description: The protein encoded by this gene interacts with CDK2, MCM5, and CDC7, and is associated with the origin recognition complex protein ORC2. It acts as a homodimer and is involved in replication and ATR-mediated checkpoint signaling. Three transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 26.400kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL
• Sequence Similarities: Belongs to the CINP family.

Gene Information

• Gene Name: CINP cyclin-dependent kinase 2 interacting protein [ Homo sapiens ]
• Official Symbol: CINP
• Synonyms: CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849
• Gene ID: 51550
• mRNA Refseq: NM_001177612
• Protein Refseq: NP_001171083
• MIM: 613362
• Uniprot ID: Q9BW66
• Chromosome Location: 14q32.33
• Function: protein binding