Recombinant Full Length Human CINP Protein, GST-tagged

• Cat.No.: CINP-1851HF
• Product Overview: Human CINP full-length ORF ( AAH00600, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 49.06 kDa
• Protein length: 212 amino acids
• AA Sequence: MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CINP cyclin-dependent kinase 2 interacting protein [ Homo sapiens ]
• Official Symbol: CINP
• Synonyms: CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849; CDK2-interacting protein
• Gene ID: 51550
• mRNA Refseq: NM_032630
• Protein Refseq: NP_116019
• MIM: 613362
• UniProt ID: Q9BW66