Recombinant Human CIB4 Protein, GST-tagged

Cat.No. : CIB4-1360H
Product Overview : Human CIB4 full-length ORF ( NP_001025052.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CIB4 (Calcium And Integrin Binding Family Member 4) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CIB1.
Molecular Mass : 48.1 kDa
AA Sequence : MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CIB4 calcium and integrin binding family member 4 [ Homo sapiens (human) ]
Official Symbol CIB4
Synonyms CIB4; calcium and integrin binding family member 4; Calcium And Integrin Binding Family Member 4; Calcium And Integrin-Binding Family Member 4; KIP4; calcium and integrin-binding family member 4
Gene ID 130106
mRNA Refseq NM_001029881
Protein Refseq NP_001025052
MIM 610646
UniProt ID A0PJX0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CIB4 Products

Required fields are marked with *

My Review for All CIB4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon