Recombinant Human CIAPIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CIAPIN1-4886H
• Product Overview: CIAPIN1 MS Standard C13 and N15-labeled recombinant protein (NP_064709) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 or CASP families. Expression of CIAPIN1 is dependent on growth factor stimulation.
• Molecular Mass: 33.6 kDa
• AA Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens (human) ]
• Official Symbol: CIAPIN1
• Synonyms: CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik
• Gene ID: 57019
• mRNA Refseq: NM_020313
• Protein Refseq: NP_064709
• MIM: 608943
• UniProt ID: Q6FI81