Recombinant Human CIAPIN1 protein, His-SUMO-tagged

• Cat.No.: CIAPIN1-4546H
• Product Overview: Recombinant Human CIAPIN1 protein(Q6FI81)(1-312aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.6 kDa
• Protein length: 1-312aa
• AA Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens ]
• Official Symbol: CIAPIN1
• Synonyms: CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik
• Gene ID: 57019
• mRNA Refseq: NM_020313
• Protein Refseq: NP_064709
• MIM: 608943
• UniProt ID: Q6FI81