Recombinant Human CHUK Protein, GST-tagged

• Cat.No.: CHUK-1351H
• Product Overview: Human CHUK partial ORF ( NP_001269, 646 a.a. - 745 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHUK conserved helix-loop-helix ubiquitous kinase [ Homo sapiens ]
• Official Symbol: CHUK
• Synonyms: CHUK; conserved helix-loop-helix ubiquitous kinase; TCF16; inhibitor of nuclear factor kappa-B kinase subunit alpha; IkBKA; IKK alpha; IKK1; IKKA; NFKBIKA; TCF-16; IKK-a kinase; I-kappa-B kinase 1; I-kappa-B kinase-alpha; transcription factor 16; IkB kinase alpha subunit; Nuclear factor NFkappaB inhibitor kinase alpha; IKBKA; IKK-alpha
• Gene ID: 1147
• mRNA Refseq: NM_001278
• Protein Refseq: NP_001269
• MIM: 600664
• UniProt ID: O15111