Recombinant Human CHST3 Protein, GST-tagged

• Cat.No.: CHST3-1343H
• Product Overview: Human CHST3 partial ORF ( NP_004264, 312 a.a. - 411 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis. [provided by RefSeq, Mar 2009]
• Molecular Mass: 36.74 kDa
• AA Sequence: VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHST3 carbohydrate (chondroitin 6) sulfotransferase 3 [ Homo sapiens ]
• Official Symbol: CHST3
• Synonyms: CHST3; carbohydrate (chondroitin 6) sulfotransferase 3; carbohydrate sulfotransferase 3; C6ST; C6ST1; GST-0; C6ST-1; chondroitin 6-O-sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; HSD
• Gene ID: 9469
• mRNA Refseq: NM_004273
• Protein Refseq: NP_004264
• MIM: 603799
• UniProt ID: Q7LGC8