Recombinant Human CHST14, His-tagged
Cat.No. : | CHST14-100H |
Product Overview : | Recombinant Human Carbohydrate Sulfotransferase 14/CHST14 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu61-Gln376) of Human CHST14 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 61-376 a.a. |
Description : | Carbohydrate Sulfotransferase 14 (CHST14) is a single-pass type II membrane protein member of the sulfotransferase 2 family. CHST14 is widely expressed and at high levels in pituitary gland, placenta, uterus and thyroid. CHST14 plays a pivotal role in the formation of 4-0-sulfated IdoA blocks in dermatan sulfate and the cerbellar neural network during postnatal brain development. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. CHST14 transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. The CHST14 transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA sequences. |
AA Sequence : | ERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQP GMPR DPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRL KMDHRSDL VFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAE IVRRYRAGAGPS PAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE RLEADANQVLEWVRAP PHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFS LFAYPLPNVTKEACQQVDHH HHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 [ Homo sapiens ] |
Official Symbol | CHST14 |
Synonyms | CHST14; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14; D4ST1, dermatan 4 sulfotransferase 1; carbohydrate sulfotransferase 14; D4ST 1; HD4ST; dermatan 4 sulfotransferase 1; ATCS; D4ST1; HNK1ST; |
Gene ID | 113189 |
mRNA Refseq | NM_130468 |
Protein Refseq | NP_569735 |
MIM | 608429 |
UniProt ID | Q8NCH0 |
Chromosome Location | 15q15.1 |
Pathway | Glycosaminoglycan biosynthesis - chondroitin sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - chondroitin sulfate, conserved biosystem; dermatan sulfate biosynthesis, organism-specific biosystem; dermatan sulfate biosynthesis, conserved biosystem; dermatan sulfate biosynthesis (late stages), organism-specific biosystem; dermatan sulfate biosynthesis (late stages), conserved biosystem; metapathway biotransformation, organism-specific biosystem; |
Function | N-acetylgalactosamine 4-O-sulfotransferase activity; phosphate ion binding; transferase activity; |
◆ Recombinant Proteins | ||
CHST14-1673M | Recombinant Mouse CHST14 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHST14-1341H | Recombinant Human CHST14 Protein, GST-tagged | +Inquiry |
CHST14-3449M | Recombinant Mouse CHST14 Protein | +Inquiry |
CHST14-1831HF | Recombinant Full Length Human CHST14 Protein, GST-tagged | +Inquiry |
CHST14-12095Z | Recombinant Zebrafish CHST14 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHST14 Products
Required fields are marked with *
My Review for All CHST14 Products
Required fields are marked with *
0
Inquiry Basket