Recombinant Human CHST11 protein, GST-tagged

• Cat.No.: CHST11-301460H
• Product Overview: Recombinant Human CHST11 (37-120 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Leu37-Tyr120
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: LHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CHST11 carbohydrate (chondroitin 4) sulfotransferase 11 [ Homo sapiens ]
• Official Symbol: CHST11
• Synonyms: CHST11; carbohydrate (chondroitin 4) sulfotransferase 11; carbohydrate sulfotransferase 11; C4ST; C4St 1; C4ST1; HSA269537; C4S-1; IgH/CHST11 fusion; chondroitin 4-O-sulfotransferase 1; C4ST-1; FLJ41682; DKFZp667A035
• Gene ID: 50515
• mRNA Refseq: NM_001173982
• Protein Refseq: NP_001167453
• MIM: 610128
• UniProt ID: Q9NPF2