Recombinant Human CHST10 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: CHST10-309H
• Product Overview: CHST10 MS Standard C13 and N15-labeled recombinant protein (NP_004845) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity. [provided by RefSeq, Feb 2011]
• Molecular Mass: 42.2 kDa
• AA Sequence: MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CHST10 carbohydrate sulfotransferase 10 [ Homo sapiens (human) ]
• Official Symbol: CHST10
• Synonyms: CHST10; carbohydrate sulfotransferase 10; HNK1ST; HNK-1ST; carbohydrate sulfotransferase 10; HNK-1 sulfotransferase; huHNK-1ST; EC 2.8.2.-
• Gene ID: 9486
• mRNA Refseq: NM_004854
• Protein Refseq: NP_004845
• MIM: 606376
• UniProt ID: O43529