Recombinant Human CHRNA7
Cat.No. : | CHRNA7-30390TH |
Product Overview : | Recombinant Human full length Nicotinic Acetylcholine Receptor alpha 7 protein with a proprietary N-terminal tag; molecular weight 61.05 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 321 amino acids |
Description : | The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from this gene and a novel FAM7A gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 61.050kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVT FTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEK ISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTM ITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAW FLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASN GNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLL HGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWK FAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDF A |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-7/CHRNA7 sub-subfamily. |
Gene Name | CHRNA7 cholinergic receptor, nicotinic, alpha 7 [ Homo sapiens ] |
Official Symbol | CHRNA7 |
Synonyms | CHRNA7; cholinergic receptor, nicotinic, alpha 7; cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7; |
Gene ID | 1139 |
mRNA Refseq | NM_000746 |
Protein Refseq | NP_000737 |
MIM | 118511 |
Uniprot ID | P36544 |
Chromosome Location | 15q13.3 |
Pathway | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Cholinergic synapse, organism-specific biosystem; |
Function | acetylcholine binding; acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; beta-amyloid binding; chloride channel regulator activity; |
◆ Recombinant Proteins | ||
CHRNA7-1394R | Recombinant Rat CHRNA7 Protein | +Inquiry |
CHRNA7-5755C | Recombinant Chicken CHRNA7 | +Inquiry |
CHRNA7-1052R | Recombinant Rat CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNa7-3216R | Recombinant Rat CHRNa7 protein, His-tagged | +Inquiry |
CHRNA7-177H | Recombinant Human CHRNA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA7-7514HCL | Recombinant Human CHRNA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNA7 Products
Required fields are marked with *
My Review for All CHRNA7 Products
Required fields are marked with *
0
Inquiry Basket