Recombinant Human CHRNA4 protein, GST-tagged

• Cat.No.: CHRNA4-22H
• Product Overview: Recombinant Human CHRNA4(29 a.a. - 128 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Alternative splicing results in multiple transcript variants.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 29-128 a.a.

Gene Information

• Gene Name: CHRNA4 cholinergic receptor, nicotinic, alpha 4 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNA4
• Synonyms: CHRNA4; cholinergic receptor, nicotinic, alpha 4 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 4 , EBN, EBN1; neuronal acetylcholine receptor subunit alpha-4; acetylcholine receptor; nicotinic; alpha 4 (neuronal); BFNC; cholinergic receptor, nicotinic, alpha polypeptide 4; neuronal nicotinic acetylcholine receptor alpha-4 subunit; EBN; EBN1; NACHR; NACRA4; NACHRA4; FLJ95812
• Gene ID: 1137
• mRNA Refseq: NM_000744
• Protein Refseq: NP_000735
• MIM: 118504
• UniProt ID: P43681
• Chromosome Location: 20
• Pathway: Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Cholinergic synapse, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem
• Function: acetylcholine binding; acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; ligand-gated ion channel activity; receptor activity