Recombinant Human CHRNA4 protein, GST-tagged

Cat.No. : CHRNA4-22H
Product Overview : Recombinant Human CHRNA4(29 a.a. - 128 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 29-128 a.a.
Description : This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CHRNA4 cholinergic receptor, nicotinic, alpha 4 (neuronal) [ Homo sapiens ]
Official Symbol CHRNA4
Synonyms CHRNA4; cholinergic receptor, nicotinic, alpha 4 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 4 , EBN, EBN1; neuronal acetylcholine receptor subunit alpha-4; acetylcholine receptor; nicotinic; alpha 4 (neuronal); BFNC; cholinergic receptor, nicotinic, alpha polypeptide 4; neuronal nicotinic acetylcholine receptor alpha-4 subunit; EBN; EBN1; NACHR; NACRA4; NACHRA4; FLJ95812;
Gene ID 1137
mRNA Refseq NM_000744
Protein Refseq NP_000735
MIM 118504
UniProt ID P43681
Chromosome Location 20
Pathway Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Cholinergic synapse, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function acetylcholine binding; acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; ligand-gated ion channel activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHRNA4 Products

Required fields are marked with *

My Review for All CHRNA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon