Recombinant Human CHRNA4 Protein, Flag-tagged
Cat.No. : | CHRNA4-88H |
Product Overview : | Recombinant Human CHRNA4 Protein is produced by HEK293 expression system. This protein is fused with a Flag tag at the C-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Description : | This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.9 kDa |
AA Sequence : | MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade after receiving vials. |
Concentration : | >50 ug/mL as determined by microplate BCA method |
Gene Name | CHRNA4 cholinergic receptor, nicotinic, alpha 4 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA4 |
Synonyms | CHRNA4; cholinergic receptor, nicotinic, alpha 4 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 4 , EBN, EBN1; EBN; EBN1; NACHR; NACRA4; NACHRA4; FLJ95812; |
Gene ID | 1137 |
mRNA Refseq | NM_000744 |
Protein Refseq | NP_000735 |
MIM | 118504 |
UniProt ID | P43681 |
◆ Recombinant Proteins | ||
Chrna4-1964M | Recombinant Mouse Chrna4 protein, His & T7-tagged | +Inquiry |
CHRNA4-11212H | Recombinant Human CHRNA4, GST-tagged | +Inquiry |
CHRNA4-1050R | Recombinant Rat CHRNA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA4-1664M | Recombinant Mouse CHRNA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA4-2673H | Recombinant Human CHRNA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA4-7515HCL | Recombinant Human CHRNA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNA4 Products
Required fields are marked with *
My Review for All CHRNA4 Products
Required fields are marked with *
0
Inquiry Basket