Recombinant Human CHRNA2 Protein, GST-Tagged

• Cat.No.: CHRNA2-1279H
• Product Overview: Human CHRNA2 partial ORF (NP_000733, 27 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels formed by a pentameric arrangement of alpha and beta subunits to create distinct muscle and neuronal receptors. Neuronal receptors are found throughout the peripheral and central nervous system where they are involved in fast synaptic transmission. This gene encodes an alpha subunit that is widely expressed in the brain. The proposed structure for nAChR subunits is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. Mutations in this gene cause autosomal dominant nocturnal frontal lobe epilepsy type 4. Single nucleotide polymorphisms (SNPs) in this gene have been associated with nicotine dependence. [provided by RefSeq, Nov 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: EEAKRPPPRAPGDPLSSPSPTALPQGGSHTETEDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPADFGNITSLRVP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHRNA2 cholinergic receptor, nicotinic, alpha 2 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNA2
• Synonyms: CHRNA2; cholinergic receptor, nicotinic, alpha 2 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal); neuronal acetylcholine receptor subunit alpha-2; acetylcholine receptor; nicotinic; alpha 2 (neuronal); acetylcholine receptor, nicotinic, alpha 2 (neuronal)
• Gene ID: 1135
• mRNA Refseq: NM_000742
• Protein Refseq: NP_000733
• MIM: 118502
• UniProt ID: Q15822