Recombinant Human CHRNA2

• Cat.No.: CHRNA2-30387TH
• Product Overview: Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 2 with N-terminal proprietary tag. Predicted MW 37.73kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels formed by a pentameric arrangement of alpha and beta subunits to create distinct muscle and neuronal receptors. Neuronal receptors are found throughout the peripheral and central nervous system where they are involved in fast synaptic transmission. This gene encodes an alpha subunit that is widely expressed in the brain. The proposed structure for nAChR subunits is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. Mutations in this gene cause autosomal dominant nocturnal frontal lobe epilepsy type 4. Single nucleotide polymorphisms (SNPs) in this gene have been associated with nicotine dependence.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EEAKRPPPRAPGDPLSSPSPTALPQGGSHTETEDRLFKHL FRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMT TNVWLKQEWSDYKLRWNPADFGNITSLRVP
• Sequence Similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-2/CHRNA2 sub-subfamily.

Gene Information

• Gene Name: CHRNA2 cholinergic receptor, nicotinic, alpha 2 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNA2
• Synonyms: CHRNA2; cholinergic receptor, nicotinic, alpha 2 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal); neuronal acetylcholine receptor subunit alpha-2
• Gene ID: 1135
• mRNA Refseq: NM_000742
• Protein Refseq: NP_000733
• MIM: 118502
• Uniprot ID: Q15822
• Chromosome Location: 8p21
• Pathway: Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem
• Function: acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity