Recombinant Human CHRNA10 protein, GST-tagged

• Cat.No.: CHRNA10-5343H
• Product Overview: Recombinant Human CHRNA10 protein(Q9GZZ6)(25-240aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: GST
• Protein length: 25-240aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.0 kDa
• AASequence: AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CHRNA10 cholinergic receptor, nicotinic, alpha 10 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNA10
• Synonyms: CHRNA10; cholinergic receptor, nicotinic, alpha 10 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 10; neuronal acetylcholine receptor subunit alpha-10; acetylcholine receptor; nicotinic; alpha 10 (neuronal); NACHR alpha-10; nicotinic acetylcholine receptor subunit alpha-10; acetylcholine receptor, nicotinic, alpha 10 (neuronal)
• Gene ID: 57053
• mRNA Refseq: NM_020402
• Protein Refseq: NP_065135
• MIM: 606372
• UniProt ID: Q9GZZ6