Recombinant Human CHMP2B Protein, GST-Tagged
Cat.No. : | CHMP2B-1250H |
Product Overview : | Human CHMP2B full-length ORF (AAH01553.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.17 kDa |
AA Sequence : | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHMP2B charged multivesicular body protein 2B [ Homo sapiens ] |
Official Symbol | CHMP2B |
Synonyms | CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B; VPS2 homolog B; vacuolar protein-sorting-associated protein 2-2; DMT1; VPS2-2; DKFZp564O123; |
Gene ID | 25978 |
mRNA Refseq | NM_001244644 |
Protein Refseq | NP_001231573 |
UniProt ID | Q9UQN3 |
◆ Recombinant Proteins | ||
CHMP2B-79HF | Recombinant Full Length Human CHMP2B Protein | +Inquiry |
CHMP2B-4985H | Recombinant Human Chromatin Modifying Protein 2B, His-tagged | +Inquiry |
CHMP2B-2491C | Recombinant Chicken CHMP2B | +Inquiry |
CHMP2B-11185H | Recombinant Human CHMP2B, His-tagged | +Inquiry |
CHMP2B-5021H | Recombinant Human CHMP2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2B-185HCL | Recombinant Human CHMP2B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHMP2B Products
Required fields are marked with *
My Review for All CHMP2B Products
Required fields are marked with *
0
Inquiry Basket