Recombinant Human CHIA Protein, GST-Tagged

• Cat.No.: CHIA-1234H
• Product Overview: Human CHIA full-length ORF (NP_068569.2, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene degrades chitin, which is found in the cell wall of most fungi as well as in arthropods and some nematodes. The encoded protein can also stimulate interleukin 13 expression, and variations in this gene can lead to asthma susceptibility. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 66.5 kDa
• AA Sequence: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHIA chitinase, acidic [ Homo sapiens ]
• Official Symbol: CHIA
• Synonyms: CHIA; chitinase, acidic; acidic mammalian chitinase; AMCase; CHIT2; TSA1902; lung-specific protein TSA1902; AMCASE; DKFZp313J1722
• Gene ID: 27159
• mRNA Refseq: NM_001040623
• Protein Refseq: NP_001035713
• MIM: 606080
• UniProt ID: Q9BZP6