Recombinant Human CHD3 Protein, GST-Tagged

Cat.No. : CHD3-1214H
Product Overview : Human CHD3 partial ORF (NP_001005273, 1654 a.a. - 1741 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.42 kDa
AA Sequence : KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHD3 chromodomain helicase DNA binding protein 3 [ Homo sapiens ]
Official Symbol CHD3
Synonyms CHD3; chromodomain helicase DNA binding protein 3; chromodomain-helicase-DNA-binding protein 3; Mi 2a; Mi2 ALPHA; ZFH; hZFH; CHD-3; zinc finger helicase; ATP-dependent helicase CHD3; mi-2 autoantigen 240 kDa protein; zinc-finger helicase (Snf2-like); Mi-2a; Mi2-ALPHA;
Gene ID 1107
mRNA Refseq NM_001005271
Protein Refseq NP_001005271
MIM 602120
UniProt ID Q12873

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHD3 Products

Required fields are marked with *

My Review for All CHD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon