Recombinant Human CHD3 Protein, GST-Tagged

• Cat.No.: CHD3-1214H
• Product Overview: Human CHD3 partial ORF (NP_001005273, 1654 a.a. - 1741 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.42 kDa
• AA Sequence: KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHD3 chromodomain helicase DNA binding protein 3 [ Homo sapiens ]
• Official Symbol: CHD3
• Synonyms: CHD3; chromodomain helicase DNA binding protein 3; chromodomain-helicase-DNA-binding protein 3; Mi 2a; Mi2 ALPHA; ZFH; hZFH; CHD-3; zinc finger helicase; ATP-dependent helicase CHD3; mi-2 autoantigen 240 kDa protein; zinc-finger helicase (Snf2-like); Mi-2a; Mi2-ALPHA
• Gene ID: 1107
• mRNA Refseq: NM_001005271
• Protein Refseq: NP_001005271
• MIM: 602120
• UniProt ID: Q12873