Recombinant Human CHCHD5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CHCHD5-1023H
• Product Overview: CHCHD5 MS Standard C13 and N15-labeled recombinant protein (NP_115685) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CHCHD5 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 5) is a Protein Coding gene. Diseases associated with CHCHD5 include Sarcocystosis. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. An important paralog of this gene is COX19.
• Molecular Mass: 12.4 kDa
• AA Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CHCHD5 coiled-coil-helix-coiled-coil-helix domain containing 5 [ Homo sapiens (human) ]
• Official Symbol: CHCHD5
• Synonyms: CHCHD5; coiled-coil-helix-coiled-coil-helix domain containing 5; C2orf9, chromosome 2 open reading frame 9; coiled-coil-helix-coiled-coil-helix domain-containing protein 5; MGC11104; C2orf9; FLJ39671
• Gene ID: 84269
• mRNA Refseq: NM_032309
• Protein Refseq: NP_115685
• MIM: 616978
• UniProt ID: Q9BSY4