Recombinant Human CHCHD10 Protein, GST-Tagged

• Cat.No.: CHCHD10-1207H
• Product Overview: Human CHCHD10 full-length ORF (AAH65232.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a mitochondrial protein that is enriched at cristae junctions in the intermembrane space. It may play a role in cristae morphology maintenance or oxidative phosphorylation. Mutations in this gene cause frontotemporal dementia and/or amyotrophic lateral sclerosis-2. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7 and 19. [provided by RefSeq, Aug 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.02 kDa
• AA Sequence: MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHCHD10 coiled-coil-helix-coiled-coil-helix domain containing 10 [ Homo sapiens ]
• Official Symbol: CHCHD10
• Synonyms: N27C7-4; C22orf16
• Gene ID: 400916
• mRNA Refseq: NM_213720
• Protein Refseq: NP_998885
• MIM: 615903
• UniProt ID: Q8WYQ3