Recombinant Human CHAT protein, GST-tagged
Cat.No. : | CHAT-177H |
Product Overview : | Recombinant Human CHAT(649 a.a. - 748 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 649 a.a. - 748 a.a. |
Description : | This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCS LLPPTESKPLATKEKATRPSQGHQP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CHAT choline O-acetyltransferase [ Homo sapiens ] |
Official Symbol | CHAT |
Synonyms | CHAT; choline O-acetyltransferase; choline acetyltransferase; choline acetylase; acetyl CoA:choline O-acetyltransferase; CMS1A; CMS1A2; CHOACTASE; |
Gene ID | 1103 |
mRNA Refseq | NM_020549 |
Protein Refseq | NP_065574 |
MIM | 118490 |
UniProt ID | P28329 |
Chromosome Location | 10q11.2 |
Pathway | Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Acetylcholine Synthesis, organism-specific biosystem; Biogenic Amine Synthesis, organism-specific biosystem; Cholinergic synapse, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Neuronal System, organism-specific biosystem; |
Function | choline O-acetyltransferase activity; choline binding; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
CHAT-1359H | Recombinant Human CHAT protein, His&Myc-tagged | +Inquiry |
CHAT-177H | Recombinant Human CHAT protein, GST-tagged | +Inquiry |
Chat-1836R | Recombinant Rat Choline O-Acetyltransferase | +Inquiry |
CHAT-2464H | Recombinant Human CHAT protein, His-tagged | +Inquiry |
CHAT-172H | Recombinant Human CHAT protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHAT Products
Required fields are marked with *
My Review for All CHAT Products
Required fields are marked with *
0
Inquiry Basket