Recombinant Human CGB7 Protein, GST-Tagged

• Cat.No.: CGB7-1190H
• Product Overview: Human CGB7 partial ORF (NP_149133, 56 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 7 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CGB7 chorionic gonadotropin, beta polypeptide 7 [ Homo sapiens ]
• Official Symbol: CGB7
• Synonyms: CGB7; chorionic gonadotropin, beta polypeptide 7; CG beta a; chorionic gonadotropin beta 7 subunit; CG-beta-a; FLJ35403; FLJ43118
• Gene ID: 94027
• mRNA Refseq: NM_033142
• Protein Refseq: NP_149133
• MIM: 608826
• UniProt ID: P01233