Recombinant Human CGB2 Protein, GST-Tagged

Cat.No. : CGB2-1186H
Product Overview : Human CGB2 partial ORF (NP_203696, 1 a.a. - 56 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene. The CGB genes are primarily distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein product corresponding to CGB2 has not been isolated. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of functional CGB subunits (PMID:8954017). However, a 163 aa protein, translated from a different frame, is about the same size, and shares 98% identity with other CGB subunits. [provided by RefSeq, Jul 2008]
Molecular Mass : 31.9 kDa
AA Sequence : MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CGB2 chorionic gonadotropin, beta polypeptide 2 [ Homo sapiens ]
Official Symbol CGB2
Synonyms CGB2; chorionic gonadotropin, beta polypeptide 2; choriogonadotropin subunit beta variant 2; product of CGB2;
Gene ID 114336
mRNA Refseq NM_033378
Protein Refseq NP_203696
MIM 608824
UniProt ID Q6NT52

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CGB2 Products

Required fields are marked with *

My Review for All CGB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon