Recombinant Human CFC1 Protein, GST-Tagged

Cat.No. : CFC1-1163H
Product Overview : Human CFC1 full-length ORF (NP_115934.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family, which are involved in signalling during embryonic development. Proteins in this family share a variant EGF-like motif, a conserved cysteine-rich domain, and a C-terminal hydrophobic region. The protein encoded by this gene is necessary for patterning the left-right embryonic axis. Mutations in this gene are associated with defects in organ development, including autosomal visceral heterotaxy and congenital heart disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Molecular Mass : 51 kDa
AA Sequence : MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAPAHPRSLVPSVLQRERRPCGRPGLGHRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFC1 cripto, FRL-1, cryptic family 1 [ Homo sapiens ]
Official Symbol CFC1
Synonyms CFC1; cripto, FRL-1, cryptic family 1; cryptic protein; CRYPTIC; HTX2; cryptic family protein 1; CFC1B; DTGA2; FLJ77897; MGC133213;
Gene ID 55997
mRNA Refseq NM_032545
Protein Refseq NP_115934
MIM 605194
UniProt ID P0CG37

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CFC1 Products

Required fields are marked with *

My Review for All CFC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon