Recombinant Human CETN2 protein, GST-tagged
| Cat.No. : | CETN2-1812H |
| Product Overview : | Recombinant Human CETN2 protein(1-172 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-172 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
| Official Symbol | CETN2 |
| Synonyms | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; caltractin (20kD calcium-binding protein); |
| Gene ID | 1069 |
| mRNA Refseq | NM_004344 |
| Protein Refseq | NP_004335 |
| MIM | 300006 |
| UniProt ID | P41208 |
| ◆ Recombinant Proteins | ||
| CETN2-118H | Recombinant Human CETN2, His tagged | +Inquiry |
| CETN2-3339M | Recombinant Mouse CETN2 Protein | +Inquiry |
| CETN2-5019C | Recombinant Chicken CETN2 | +Inquiry |
| CETN2-754H | Recombinant Human CETN2 Protein, His-tagged | +Inquiry |
| CETN2-2688H | Recombinant Human CETN2 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *
