Recombinant Human CETN2 protein, GST-tagged
Cat.No. : | CETN2-1812H |
Product Overview : | Recombinant Human CETN2 protein(1-172 aa), fused to GST tag, was expressed in E. coli. |
Availability | March 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-172 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
Official Symbol | CETN2 |
Synonyms | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; caltractin (20kD calcium-binding protein); |
Gene ID | 1069 |
mRNA Refseq | NM_004344 |
Protein Refseq | NP_004335 |
MIM | 300006 |
UniProt ID | P41208 |
◆ Recombinant Proteins | ||
CETN2-2688H | Recombinant Human CETN2 protein, His-SUMO-tagged | +Inquiry |
CETN2-1812H | Recombinant Human CETN2 protein, GST-tagged | +Inquiry |
CETN2-639H | Recombinant Human CETN2 Protein, His-tagged | +Inquiry |
CETN2-3339M | Recombinant Mouse CETN2 Protein | +Inquiry |
CETN2-3375H | Recombinant Human Centrin, EF-Hand Protein, 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *
0
Inquiry Basket