Recombinant Human CERS4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CERS4-4824H |
Product Overview : | LASS4 MS Standard C13 and N15-labeled recombinant protein (NP_078828) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CERS4 (Ceramide Synthase 4) is a Protein Coding gene. Diseases associated with CERS4 include Fetal Akinesia Deformation Sequence 1. Among its related pathways are Sphingolipid signaling pathway and Sphingolipid metabolism. Gene Ontology (GO) annotations related to this gene include sphingosine N-acyltransferase activity. An important paralog of this gene is CERS2. |
Molecular Mass : | 46.4 kDa |
AA Sequence : | MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEVAAAQEPLQLKNGAAGGPRPAPTDGPQSRVAGRLTNRHTTATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CERS4 ceramide synthase 4 [ Homo sapiens (human) ] |
Official Symbol | CERS4 |
Synonyms | CERS4; ceramide synthase 4; LAG1 homolog, ceramide synthase 4, LAG1 longevity assurance homolog 4 (S. cerevisiae), LASS4; FLJ12089; Trh1; LAG1 homolog, ceramide synthase 4; LAG1 longevity assurance homolog 4; LASS4; |
Gene ID | 79603 |
mRNA Refseq | NM_024552 |
Protein Refseq | NP_078828 |
MIM | 615334 |
UniProt ID | Q9HA82 |
◆ Cell & Tissue Lysates | ||
CERS4-4818HCL | Recombinant Human LASS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CERS4 Products
Required fields are marked with *
My Review for All CERS4 Products
Required fields are marked with *
0
Inquiry Basket