Recombinant Human CEP250 Protein, GST-Tagged

• Cat.No.: CEP250-1132H
• Product Overview: Human CEP2 partial ORF (AAH01433, 141 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a core centrosomal protein required for centriole-centriole cohesion during interphase of the cell cycle. The encoded protein dissociates from the centrosomes when parental centrioles separate at the beginning of mitosis. The protein associates with and is phosphorylated by NIMA-related kinase 2, which is also associated with the centrosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
• Molecular Mass: 36.63 kDa
• AA Sequence: LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEP250 centrosomal protein 250kDa [ Homo sapiens ]
• Official Symbol: CEP250
• Synonyms: CEP250; centrosomal protein 250kDa; centrosomal protein 2, CEP2; centrosome-associated protein CEP250; C NAP1; 250 kDa centrosomal protein; centrosomal protein, 250-KD; centrosome associated protein; centrosomal Nek2-associated protein 1; CEP2; CNAP1; C-NAP1; MGC88542
• Gene ID: 11190
• mRNA Refseq: NM_007186
• Protein Refseq: NP_009117
• MIM: 609689
• UniProt ID: Q9BV73