Recombinant Human CEP20 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CEP20-1488H
• Product Overview: C16orf63 MS Standard C13 and N15-labeled recombinant protein (NP_653201) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CEP20 (Centrosomal Protein 20) is a Protein Coding gene. Diseases associated with CEP20 include Angular Cheilitis.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.8 kDa
• AA Sequence: MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CEP20 centrosomal protein 20 [ Homo sapiens (human) ]
• Official Symbol: CEP20
• Synonyms: CEP20; centrosomal protein 20; FOPNL; FOR20; C16orf63; PHSECRG2; centrosomal protein 20; FGFR1OP N-terminal like; FOP-related protein of 20 kDa; lisH domain-containing protein C16orf63; lisH domain-containing protein FOPNL; pluripotent embryonic stem cell-related protein
• Gene ID: 123811
• mRNA Refseq: NM_144600
• Protein Refseq: NP_653201
• MIM: 617149
• UniProt ID: Q96NB1