Recombinant Human CENPH, His-tagged

Cat.No. : CENPH-27395TH
Product Overview : Recombinant fragment, corresponding to amino acids 9-247 of Human CENPH with an N-terminal His Tag, approximately 42kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 9-247 a.a.
Description : Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex.
Conjugation : HIS
Form : Lyophilised:reconstitution with 102 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRA QTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLE NEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSS VLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQL KQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNL QMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQL EKNVDMM
Sequence Similarities : Belongs to the centromere protein H family.
Gene Name CENPH centromere protein H [ Homo sapiens ]
Official Symbol CENPH
Synonyms CENPH; centromere protein H; NNF1; MIND kinetochore complex component; homolog (S. cerevisiae); PMF1;
Gene ID 64946
mRNA Refseq NM_022909
Protein Refseq NP_075060
MIM 605607
Uniprot ID Q9H3R5
Chromosome Location 5p15.2
Pathway Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Replication, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; M Phase, organism-specific biosystem;
Function kinetochore binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CENPH Products

Required fields are marked with *

My Review for All CENPH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon