Recombinant Human CENPE Protein, GST-Tagged
Cat.No. : | CENPE-1114H |
Product Overview : | Human CENPE partial ORF (NP_001804, 309 a.a. - 419 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Centrosome-associated protein E (CENPE) is a kinesin-like motor protein that accumulates in the G2 phase of the cell cycle. Unlike other centrosome-associated proteins, it is not present during interphase and first appears at the centromere region of chromosomes during prometaphase. This protein is required for stable spindle microtubule capture at kinetochores which is a necessary step in chromosome alignment during prometaphase. This protein also couples chromosome position to microtubule depolymerizing activity. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 37.95 kDa |
AA Sequence : | TPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CENPE centromere protein E, 312kDa [ Homo sapiens ] |
Official Symbol | CENPE |
Synonyms | CENPE; centromere protein E, 312kDa; centromere protein E (312kD); centromere-associated protein E; KIF10; PPP1R61; protein phosphatase 1; regulatory subunit 61; kinesin family member 10; kinesin-related protein CENPE; Centromere autoantigen E (312kD); protein phosphatase 1, regulatory subunit 61; CENP-E; |
Gene ID | 1062 |
mRNA Refseq | NM_001813 |
Protein Refseq | NP_001804 |
MIM | 117143 |
UniProt ID | Q02224 |
◆ Recombinant Proteins | ||
Cenpe-349R | Recombinant Rat Cenpe Protein, His-tagged | +Inquiry |
CENPE-348H | Recombinant Human CENPE Protein, His-tagged | +Inquiry |
CENPE-3800H | Recombinant Human CENPE protein, His-tagged | +Inquiry |
CENPE-4563Z | Recombinant Zebrafish CENPE | +Inquiry |
CENPE-1114H | Recombinant Human CENPE Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CENPE Products
Required fields are marked with *
My Review for All CENPE Products
Required fields are marked with *
0
Inquiry Basket